服務(wù)熱線
400-021-2200
現(xiàn)貨供應(yīng)，歡迎訂購: :
Adiponectin Human Recombinant
| Catalogue Number | CYT-280 | |||||||||||
| Synonyms | Acrp30, AdipoQ, GBP-28, APM-1, ACDC. | |||||||||||
| Introduction | The adipose tissue exclusively expresses and secretes Adiponectin (Acrp30). Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity. Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced. The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain. Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling through a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules. | |||||||||||
| Patent Rights | The sale and/or commercial use of Recombinant Adiponectin is prohibited in the United States of America (U.S.A). | |||||||||||
| Description | The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244). | |||||||||||
| Source | Escherichia Coli. | |||||||||||
| Physical Appearance | Sterile Filtered clear solution. | |||||||||||
| Formulation | Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1mM DTT. | |||||||||||
| Storage | Store Acrp30 at -20°C. Can be stored at 4°C for a limited period of time of 7 days. | |||||||||||
| Purity | Acrp30 purity is greater than 90% as determined by SDS-PAGE. | |||||||||||
| Amino Acid Sequence | MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE KGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSV GLETYVTIPNMPIRFTKIFYNNHYDGSTGKFHCNIPGLYYFAYHITVYMKD VKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGE RNGLYADNDNDSTFTGFLLYHDTN. | |||||||||||
| Usage | ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. | |||||||||||
| Related Products |
|
Related Products
Activin A cyt-569 Recombinant Human Activin-A
Activin A Plant-Active cyt-414 Recombinant Human Activin-A Active
Activin A HEK-Active cyt-078 Recombinant Human Activin-A HEK-Active
Activin A Plant cyt-052 Recombinant Human Activin-A, Plant
Activin B Active cyt-057 Recombinant Human Activin-B Active
Activin B cyt-058 Recombinant Human Activin-B
Activin A, Active cyt-145 Recombinant Human Activin-A, Active
mActivin A cyt-146 Recombinant Mouse Activin-A
rActivin A cyt-147 Recombinant Rat Activin-A
Acrp30 cyt-024 Human Adiponectin
Acrp30 cyt-280 Recombinant Human Adiponectin
Acrp30 His cyt-433 Recombinant Human Adiponectin, His tag
mAcrp30 His cyt-537 Recombinant Mouse Adiponectin, His tag
Acrp30 HEK cyt-434 Recombinant Human Adiponectin glycosilated, HEK
mAcrp30 HEK cyt-435 Recombinant Mouse Adiponectin glycosilated, HEK
pAcrp30 HEK cyt-696 Recombinant Porcine Adiponectin glycosilated, HEK
Acrp30 Tri cyt-233 Recombinant Human Adiponectin Trimeric Form
mAcrp30 Tri cyt-247 Recombinant Mouse Adiponectin Trimeric Form
gAcrp30 cyt-615 Recombinant Human Adiponectin Globular
gAcrp30 His cyt-277 Recombinant Human Adiponectin Globular, His tag
mgAcrp30 cyt-432 Recombinant Mouse Adiponectin Globular
AIF1 cyt-697 Recombinant Human Allograft Inflammatory Factor 1
AIF1L cyt-007 Recombinant Human Allograft Inflammatory Factor 1 Like
AITRL cyt-076 Recombinant Human AITRL
AITRL His cyt-317 Recombinant Human AITRL, His Tag
ANGPT1 cyt-074 Recombinant Human Angiopoietin-1
ANGPTL3 cyt-248 Recombinant Human Angiopoietin-like Protein 3
ANGPTL4 cyt-249 Recombinant Human Angiopoietin-like Protein 4
ANGPTL4 HEK cyt-698 Recombinant Human Angiopoietin-like Protein 4, HEK
APOA1 cyt-661 Recombinant Human Apolipoprotein A-I
APOA1 cyt-037 Human Apolipoprotein A-I
APOA2 cyt-038 Human Apolipoprotein A-II
APOA5 cyt-025 Recombinant Human Apolipoprotein A-V
AREG cyt-041 Recombinant Human Amphiregulin
Clusterin cyt-278 Recombinant Human Apoliprotein-J
Clusterin cyt-548 Human Apoliprotein-J
rClusterin cyt-437 Recombinant Rat Apoliprotein-J
k9Clusterin cyt-549 Recombinant Canine Apoliprotein-J
k9Clusterin HEK cyt-618 Recombinant Canine Apoliprotein-J HEK
APO D cyt-547 Recombinant Human Apoliprotein-D
APO D GST cyt-652 Recombinant Human APO-D GST Tag
APOH cyt-189 Recombinant Human Apoliprotein-H
APOM cyt-715 Recombinant Human Apolipoprotein-M
APOM HEK cyt-026 Recombinant Human Apolipoprotein-M, HEK
Artemin cyt-306 Recombinant Human Artemin
BD 1 cyt-564 Recombinant Human Beta Defensin -1
mBD 1 cyt-044 Recombinant Mouse Beta Defensin -1
rBD 1 cyt-062 Recombinant Rat Beta Defensin -1
BD 2 cyt-571 Recombinant Human Beta Defensin -2
mBD 2 cyt-035 Recombinant Mouse Beta Defensin -2
BD 3 cyt-461 Recombinant Human Beta Defensin -3
mBD 3 cyt-036 Recombinant Mouse Beta Defensin -3
rBD 3 cyt-063 Recombinant Rat Beta Defensin -3
BD 4 cyt-599 Recombinant Human Beta Defensin -4
rBD 4 cyt-066 Recombinant Rat Beta Defensin -4
BDNF cyt-207 Recombinant Human Brain-Derived Neurotrophic Factor
proBDNF cyt-014 Recombinant Human Precursor Brain-Derived Neurotrophic Factor
BAFF cyt-307 Recombinant Human BAFF (BLyS)
BAFF His cyt-545 Recombinant Human BAFF (BLyS), His Tag
BAFF Plant cyt-054 Recombinant Human BAFF (BLyS), Plant
BAFF R cyt-429 Recombinant Human BAFF (BLyS) Receptor
BMPR1A cyt-380 Recombinant Human Bone Morphogenetic protein Receptor-1A
BMPR1A HEK cyt-713 Recombinant Human Bone Morphogenetic protein Receptor-1A HEK
BMP 2 cyt-261 Recombinant Human Bone Morphogenetic protein-2
BMP 2 HEK cyt-080 Recombinant Human Bone Morphogenetic protein-2, HEK
BMP 2 Mono cyt-627 Recombinant Human Bone Morphogenetic protein-2 Monomer
Pro BMP 2 cyt-427 Recombinant Human Pro Bone Morphogenetic protein-2
BMP 4 cyt-361 Recombinant Human Bone Morphogenetic protein-4
BMP 4 Active cyt-081 Recombinant Human Bone Morphogenetic protein-4 Active
BMP 5 cyt-660 Recombinant Human Bone Morphogenetic protein-5
BMP 7 cyt-333 Recombinant Human Bone Morphogenetic protein-7
BMP 7 His cyt-629 Recombinant Human Bone Morphogenetic protein-7 His Tag
BMP 7 CHO cyt-276 Recombinant Human Bone Morphogenetic protein-7, CHO
BMP 7 Plant cyt-039 Recombinant Human Bone Morphogenetic protein-7, Plant
BMP 7 HEK cyt-082 Recombinant Human Bone Morphogenetic protein-7, HEK
b NGF cyt-579 Recombinant Human beta Nerve Growth Factor
b NGF CHO cyt-246 Recombinant Human beta Nerve Growth Factor, CHO
b NGF HEK cyt-079 Recombinant Human beta Nerve Growth Factor, HEK
mb NGF cyt-581 Recombinant Mouse beta Nerve Growth Factor
mb NGF cyt-440 Mouse beta Nerve Growth Factor
ProNGF cyt-426 Recombinant Human Pro-Nerve Growth Factor
BNP cyt-327 Recombinant Human B-type Natriuretic Protein
BNP His cyt-605 Recombinant Human B-type Natriuretic Protein His Tag
BNP cyt-369 Human B-type Natriuretic Protein
BST2 cyt-059 Recombinant Human Bone Marrow Stromal Cell Antigen 2
BTC cyt-330 Recombinant Human Betacellulin
BTC His cyt-077 Recombinant Human Betacellulin, His Tag
mBTC cyt-131 Recombinant Mouse Betacellulin
bBTC cyt-406 Recombinant Bovine Betacellulin
CDNF cyt-167 Recombinant Human Cerebral Dopamine Neurotrophic Factor
mCDNF cyt-729 Recombinant Mouse Cerebral Dopamine Neurotrophic Factor
rCDNF cyt-730 Recombinant Rat Cerebral Dopamine Neurotrophic Factor
CLCF1 cyt-071 Recombinant Human Cardiotrophin-Like Cytokine Factor 1
CNTF cyt-272 Recombinant Human Ciliary Neurotrophic Factor
CNTF His cyt-573 Recombinant Human Ciliary Neurotrophic Factor, His Tag
mCNTF cyt-139 Recombinant Mouse Ciliary Neurotrophic Factor
rCNTF cyt-654 Recombinant Rat Ciliary Neurotrophic Factor
CT 1 cyt-436 Recombinant Human Cardiotrophin-1
mCT 1 cyt-151 Recombinant Mouse Cardiotrophin-1
rCT 1 cyt-199 Recombinant Rat Cardiotrophin-1
CTGF cyt-541 Recombinant Human Connective Tissue Growth Factor
CTGF His cyt-438 Recombinant Human Connective Tissue Growth Factor, His Tag
CTGF (182-250 a.a.) cyt-526 Recombinant Human Connective Tissue Growth Factor 182-250 a.a.
CTGF HEK cyt-687 Recombinant Human Connective Tissue Growth Factor, HEK
CTLA 4 cyt-366 Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4
CYR61 cyt-164 Recombinant Human Cysteine-Rich Angiogenic Inducer 61
EBI3 cyt-367 Recombinant Human Epstein Barr Virus Induced 3
EBI3 His cyt-668 Recombinant Human Epstein Barr Virus Induced 3, His Tag
mEBI3 cyt-621 Recombinant Mouse Epstein Barr Virus Induced 3
EG VEGF cyt-338 Recombinant Human Endocrine Gland Vacular Endothelial Growth Factor
EGF cyt-217 Recombinant Human Epidermal Growth Factor
EGF Pichia cyt-332 Recombinant Human Epidermal Growth Factor, Pichia
EGF (Leu 21) cyt-466 Recombinant Human Epidermal Growth Factor 21-Leu
mEGF cyt-326 Recombinant Mouse Epidermal Growth Factor
mEGF cyt-554 Mouse Epidermal Growth Factor
mEGF, His cyt-138 Recombinant Mouse Epidermal Growth Factor, His
rEGF cyt-556 Rat Epidermal Growth Factor
rEGF cyt-669 Recombinant Rat Epidermal Growth Factor
EMAP II cyt-607 Recombinant Human Endothelial-Monocyte Activating Polypeptide II
AIMP1 cyt-021 Recombinant Human Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1
Endoglin Sf9 cyt-389 Recombinant Human Endoglin, Sf9
Endoglin cyt-525 Recombinant Human Endoglin
mEndoglin cyt-424 Recombinant Mouse Endoglin
EPGN cyt-601 Recombinant Human Epigen
EREG cyt-609 Recombinant Human Epiregulin
EPO a cyt-201 Recombinant Human Erythropoietin-alpha
EPO a Fc cyt-325 Recombinant Human Erythropoietin-alpha Fc/Chimera
EPO a HEK cyt-083 Recombinant Human Erythropoietin-alpha, HEK
FAS cyt-125 Recombinant Human sFas Receptor
FASLG cyt-031 Recombinant Human FAS Ligand
FASLG HEK cyt-051 Recombinant Human FAS Ligand, HEK
FGF 1 cyt-264 Recombinant Human Fibroblast Growth Factor-acidic
FGF 1 Sf9 cyt-364 Recombinant Human Fibroblast Growth Factor-acidic, Sf9
mFGF 1 cyt-528 Recombinant Mouse Fibroblast Growth Factor-acidic
mFGF 1 His cyt-072 Recombinant Mouse Fibroblast Growth Factor-acidic, His Tag
rFGF 1 cyt-075 Recombinant Rat Fibroblast Growth Factor-acidic
baFGF cyt-613 Bovine Fibroblast Growth Factor-acidic
FGF 2 cyt-218 Recombinant Human Fibroblast Growth Factor-basic
FGF 2 Sf9 cyt-365 Recombinant Human Fibroblast Growth Factor-basic, Sf9
FGF 2 (147 a.a.) cyt-557 Recombinant Human Fibroblast Growth Factor-basic (147 a.a)
FGF 2 293 Cells cyt-085 Recombinant Human Fibroblast Growth Factor-basic, 293 Cells
FGF2 Plant cyt-123 Recombinant Human Fibroblast Growth Factor-basic, Plant
bFGF 2 cyt-288 Recombinant Bovine Fibroblast Growth Factor-basic
bFGF 2 cyt-560 Bovine Fibroblast Growth Factor-basic
mFGF 2 cyt-386 Recombinant Mouse Fibroblast Growth Factor-basic
rFGF 2 cyt-608 Recombinant Rat Fibroblast Growth Factor-basic
FGF 4 cyt-312 Recombinant Human Fibroblast Growth Factor-4
FGF 4 HEK cyt-084 Recombinant Human Fibroblast Growth Factor-4, HEK
FGF 8 cyt-714 Recombinant Human Fibroblast Growth Factor-8
mFGF 8 cyt-070 Recombinant Mouse Fibroblast Growth Factor-8
FGF 8 HEK cyt-087 Recombinant Human Fibroblast Growth Factor-8, HEK
FGF 9 cyt-415 Recombinant Human Fibroblast Growth Factor-9
mFGF 9 cyt-349 Recombinant Mouse Fibroblast Growth Factor-9
rFGF 9 cyt-558 Recombinant Rat Fibroblast Growth Factor-9
FGF12 cyt-620 Recombinant Human Fibroblast Growth Factor 12
FGF13 cyt-121 Recombinant Human Fibroblast Growth Factor 13
mFGF-15 cyt-027 Recombinant Mouse Fibroblast Growth Factor-15
FGF-18 cyt-120 Recombinant Human Fibroblast Growth Factor-18
mFGF-18 cyt-064 Recombinant Mouse Fibroblast Growth Factor-18
rFGF-18 cyt-176 Recombinant Rat Fibroblast Growth Factor-18
FGF 19 cyt-700 Recombinant Human Fibroblast Growth Factor-19
FGF 19 His cyt-279 Recombinant Human Fibroblast Growth Factor-19 His Tag
FGF 21 cyt-474 Recombinant Human Fibroblast Growth Factor-21
FGF 21 His cyt-281 Recombinant Human Fibroblast Growth Factor-21, His Tag
mFGF 21 cyt-339 Recombinant Mouse Fibroblast Growth Factor-21
mFGF 21 His cyt-516 Recombinant Mouse Fibroblast Growth Factor-21, His Tag
rFGF 21 cyt-130 Recombinant Rat Fibroblast Growth Factor-21
bFGF 21 cyt-657 Recombinant Bovine Fibroblast Growth Factor-21
FGF 22 cyt-428 Recombinant Human Fibroblast Growth Factor-22
FGF 23 cyt-020 Recombinant Human Fibroblast Growth Factor-23
FGF 23 His cyt-374 Recombinant Human Fibroblast Growth Factor-23 His Tag
FGF 23 C-term cyt-028 Recombinant Human Fibroblast Growth Factor-23 C-Terminal
Flt3 Ligand cyt-331 Recombinant Human Flt3-Ligand
Flt3 Ligand HEK cyt-706 Recombinant Human Flt3-Ligand, HEK
Flt3 Ligand Sf9 cyt-409 Recombinant Human Flt3-Ligand, Sf9
mFlt3 Ligand cyt-340 Recombinant Mouse Flt3-Ligand
rmFlt3 Ligand cyt-157 Recombinant Rhesus Macaque Flt3-Ligand
FST cyt-232 Recombinant Human Follistatin
FST His cyt-029 Recombinant Human Follistatin His Tag
mFST cyt-124 Recombinant Mouse Follistatin
HB-EGF cyt-119 Recombinant Human Proheparin-Binding EGF-like Growth Factor
mHB-EGF cyt-068 Recombinant Mouse Proheparin-Binding EGF-like Growth Factor
rHB-EGF cyt-170 Recombinant Rat Proheparin-Binding EGF-like Growth Factor
LGALS1 cyt-544 Recombinant Human Galectin-1
mLGALS1 cyt-186 Recombinant Mouse Galectin-1
LGALS2 cyt-725 Recombinant Human Galectin-2
mLGALS2 cyt-019 Recombinant Mouse Galectin-2
LGALS3 cyt-606 Recombinant Human Galectin-3
LGALS3 His cyt-693 Recombinant Human Galectin-3 His Tag
mLGALS3 cyt-188 Recombinant Mouse Galectin-3
LGALS4 cyt-686 Recombinant Human Galectin-4
mLGALS4 cyt-187 Recombinant Mouse Galectin-4
LGALS7 cyt-016 Recombinant Human Galectin-7
LGALS7 His cyt-617 Recombinant Human Galectin-7 His Tag
mLGALS7 cyt-184 Recombinant Mouse Galectin-7
LGALS8 cyt-017 Recombinant Human Galectin-8
LGALS8 His cyt-727 Recombinant Human Galectin-8, His Tag
mLGALS8 cyt-185 Recombinant Mouse Galectin-8
LGALS9 cyt-708 Recombinant Human Galectin-9
mLGALS9 cyt-550 Recombinant Mouse Galectin-9
LGALS13 cyt-004 Recombinant Human Galectin-13
LGALS14 cyt-003 Recombinant Human Galectin-14
LGALSL cyt-073 Recombinant Human Galectin-Related Protein
GDNF cyt-305 Recombinant Human Glial-Derived Neurotrophic Factor
GDF3 cyt-694 Recombinant Human Growth and Differentiation factor 3
GDF5 cyt-442 Recombinant Human Growth and Differentiation factor 5
GDF5 His cyt-653 Recombinant Human Growth and Differentiation factor 5 His Tag
GDF10 cyt-659 Recombinant Human Growth and Differentiation factor 10
GDF15 His cyt-691 Recombinant Human Growth and Differentiation factor 15, His Tag
GDF15 D cyt-314 Recombinant Human Growth and Differentiation factor 15 D-Vairant
GDF15 cyt-335 Recombinant Human Growth and Differentiation factor 15
G CSF cyt-220 Recombinant Human Granulocyte-Colony Stimulating Factor
G CSF His cyt-476 Recombinant Human Granulocyte-Colony Stimulating Factor, His Tag
G CSF CHO cyt-329 Recombinant Human Granulocyte-Colony Stimulating Factor, CHO
G CSF PEG cyt-018 Recombinant Human Pegylated Granulocyte-Colony Stimulating Factor
G CSF HEK cyt-088 Recombinant Human Granulocyte-Colony Stimulating Factor, HEK
mG CSF cyt-410 Recombinant Mouse Granulocyte-Colony Stimulating Factor
GH cyt-202 Recombinant Human Growth Hormone
pGH 22kDa cyt-235 Recombinant Human Placental Corr Growth Hormone
GH 20kDa cyt-259 Recombinant Human Pituitary Growth Hormone 20kDa
pGH 20kDa cyt-337 Recombinant Human Placental Growth Hormone 20kDa
GH Plant cyt-053 Recombinant Human Growth Hormone, Plant
GH HEK cyt-091 Recombinant Human Growth Hormone, HEK
GHBP cyt-238 Recombinant Human Growth Hormone Binding Protein
oGHBP cyt-470 Recombinant Ovine Growth Hormone Binding Protein
bGHBP cyt-471 Recombinant Bovine Growth Hormone Binding Protein
raGHBP cyt-593 Recombinant Rabbit Growth Hormone Binding Protein
chGH cyt-430 Recombinant Chicken Growth Hormone
oGH cyt-237 Recombinant Ovine Growth Hormone
oGH Placental cyt-594 Recombinant Placental Ovine Growth Hormone
bGH cyt-636 Recombinant Bovine Growth Hormone
mGH cyt-540 Recombinant Mouse Growth Hormone
rGH cyt-296 Recombinant Rat Growth Hormone
cGH cyt-297 Recombinant Carp Growth Hormone
dGH cyt-498 Recombinant Denis Growth Hormone
maiGH cyt-499 Recombinant Mai Mai Growth Hormone
sGH cyt-529 Recombinant Gilthead Seabream Growth Hormone
raGH cyt-514 Recombinant Rabbit Growth Hormone
pGH cyt-519 Recombinant Porcine Growth Hormone
chGH Antagonist cyt-538 Recombinant Chicken Growth Hormone Anatagonist
oGH Antagonist cyt-215 Recombinant Ovine Growth Hormone Anatagonist
zGH cyt-710 Recombinant Zebrafish Growth Hormone
zGH Mutant cyt-709 Recombinant Zebrafish Growth Hormone Mutant
GM CSF cyt-221 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor
GM CSF Pichia cyt-324 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Pichia
GM CSF Sf9 cyt-416 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Sf9
GM CSF HEK cyt-089 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, HEK
GM CSF His cyt-477 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, His Tag
PIXY321 cyt-360 Recombinant Human gm-csf/IL-3 Fusion Protein (PIXY321)
mGM CSF cyt-222 Recombinant Mouse Granulocyte Macrophage-Colony Stimulating Factor
rGM CSF cyt-395 Recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor
pGM CSF cyt-401 Recombinant Porcine Granulocyte Macrophage-Colony Stimulating Factor
rmGM CSF cyt-720 Recombinant Rhesus Macaque Granulocyte Macrophage-Colony Stimulating Factor
k9GM CSF cyt-724 Recombinant Canine Granulocyte Macrophage-Colony Stimulating Factor
GMF b cyt-565 Recombinant Human Glia Maturation Factor Beta
GMF b His cyt-726 Recombinant Human Glia Maturation Factor Beta His Tag
mGMF b cyt-006 Recombinant Mouse Glia Maturation Factor Beta
rGMF b cyt-049 Recombinant Rat Glia Maturation Factor Beta
GMFG cyt-632 Recombinant Human Glia Maturation Factor Gamma
HDGF cyt-681 Recombinant Human Hepatoma-Derived Growth Factor
HDGF2 cyt-132 Recombinant Human Hepatoma-Derived Growth Factor-2
HGF CHO cyt-251 Recombinant Human Hepatocyte Growth Factor, CHO
HGF Sf9 cyt-244 Recombinant Human Hepatocyte Growth Factor, Sf9
HGF HEK cyt-090 Recombinant Human Hepatocyte Growth Factor, HEK
HGF-A cyt-664 Recombinant Human Hepatocyte Growth Factor A Chain
HGF-B cyt-665 Recombinant Human Hepatocyte Growth Factor B Chain
pHGF cyt-522 Porcine Hepatocyte Promoting Growth Factor
IFI30 cyt-183 Recombinant Human Interferon Gamma-Inducible protein 30
IFN a 1 cyt-291 Recombinant Human Interferon-alpha 1
IFN a 1a cyt-520 Recombinant Human Interferon-alpha 1a
IFN a 1b cyt-283 Recombinant Human Interferon-alpha 1b
IFN a 2a cyt-204 Recombinant Human Interferon-alpha 2a
IFN a 2a Plant cyt-543 Recombinant Human Interferon-alpha 2a, Tobacco
IFN a 2b cyt-205 Recombinant Human Interferon-alpha 2b
IFN a 2b Yeast cyt-460 Recombinant Human Interferon-alpha 2b, Saccharomyces
IFN a 2b 20kd-PEG cyt-034 Recombinant Human Interferon-alpha 2b 20kd-Pegylated
IFN a 2b HEK cyt-092 Recombinant Human Interferon-alpha 2b, HEK
IFN a 2a HEK cyt-093 Recombinant Human Interferon-alpha 2a, HEK
IFNA7 cyt-196 Recombinant Human Interferon-alpha 7
IFNA14 cyt-135 Recombinant Human Interferon-alpha 14
IFN b 1a cyt-236 Recombinant Human Interferon-beta 1a
IFN b 1b cyt-234 Recombinant Human Interferon-beta 1b
mIFN b His cyt-651 Recombinant Mouse Interferon-beta His Tag
IFN g cyt-206 Recombinant Human Interferon-gamma
IFN g His cyt-478 Recombinant Human Interferon-gamma His Tag
mIFN g cyt-358 Recombinant Mouse Interferon-gamma
rIFN g cyt-359 Recombinant Rat Interferon-gamma
pIFN g cyt-402 Recombinant Porcine Interferon-gamma
qIFN g cyt-739 Recombinant Equine Interferon-gamma
IFNW1 cyt-040 Recombinant Human Interferon-Omega 1
oIFN tau cyt-377 Recombinant Ovine Interferon-Tau
IRF 1 cyt-449 Recombinant Human Interferon Regulatory Factor-1
IRF 2 cyt-534 Recombinant Human Interferon Regulatory Factor-2
IRF 3 cyt-292 Recombinant Human Interferon Regulatory Factor-3
IGF1 cyt-216 Recombinant Human Insulin Like Growth Factor-1
IGF1 GST cyt-690 Recombinant Human Insulin Like Growth Factor-1, GST-Tag
IGF1 Des1-3 cyt-518 Recombinant Human Insulin Like Growth Factor-1 Des (1-3)
Long R3 IGF1 cyt-022 Recombinant Human LR3 Insulin Like Growth Factor-1
IGF1 N15 cyt-128 Recombinant Human Insulin Like Growth Factor-1 N15 Labeled
mIGF1 cyt-229 Recombinant Mouse Insulin Like Growth Factor-1
rIGF1 cyt-289 Recombinant Rat Insulin Like Growth Factor-1
sIGF1 cyt-295 Recombinant Gilthead Seabream Insulin Like Growth Factor-1
IGF2 cyt-265 Recombinant Human Insulin Like Growth Factor-2
pro-IGF2 cyt-110 Recombinant Human Pro-Insulin Like Growth Factor-2
IGFBP 1 cyt-299 Human Insulin Like Growth Factor Binding Protein-1
IGFBP 3 cyt-300 Recombinant Human Insulin Like Growth Factor Binding Protein-3
IGFBP 4 cyt-030 Recombinant Human Insulin Like Growth Factor Binding Protein-4
IGFBP 5 cyt-464 Recombinant Human Insulin Like Growth Factor Binding Protein-5
IGFBP 6 cyt-258 Recombinant Human Insulin Like Growth Factor Binding Protein-6
IHH cyt-195 Recombinant Human Indian Hedgehog
IL 1 alpha cyt-253 Recombinant Human Interleukin-1 alpha
IL 1 alpha His cyt-479 Recombinant Human Interleukin-1 alpha, His Tag
mIL 1 alpha cyt-523 Recombinant Mouse Interleukin-1 alpha
rIL 1 alpha cyt-381 Recombinant Rat Interleukin-1 alpha
pIL 1 alpha cyt-396 Recombinant Porcine Interleukin-1 alpha
IL 1 beta cyt-208 Recombinant Human Interleukin-1 beta
IL 1 beta His cyt-480 Recombinant Human Interleukin-1 beta, His Tag
IL 1 beta HEK cyt-094 Recombinant Human Interleukin-1 beta, HEK
mIL 1 beta cyt-273 Recombinant Mouse Interleukin-1 beta
mIL 1 beta His cyt-578 Recombinant Mouse Interleukin-1 beta, His Tag
rIL 1 beta cyt-394 Recombinant Rat Interleukin-1 beta
pIL 1 beta cyt-400 Recombinant Porcine Interleukin-1 beta
rmIL 1 beta cyt-718 Recombinant Rhesus Macaque Interleukin-1 beta
IL 1RA cyt-203 Recombinant Human Interleukin-1 Receptor Antagonist
IL 1RA His cyt-481 Recombinant Human Interleukin-1 Receptor Antagonist, His Tag
IL1RL1 cyt-671 Recombinant Human Interleukin-1 Receptor Like-1
mIL 1RA cyt-658 Recombinant Mouse Interleukin-1 Receptor Antagonist
mIL 1RA His cyt-136 Recombinant Mouse Interleukin-1 Receptor Antagonist, His Tag
rIL 1RA cyt-152 Recombinant Rat Interleukin-1 Receptor Antagonist
hIL 1RA cyt-010 Recombinant Horse Interleukin-1 Receptor Antagonist
IL 2 cyt-209 Recombinant Human Interleukin-2
IL 2 His cyt-666 Recombinant Human Interleukin-2 His Tag
IL 2 HEK cyt-095 Recombinant Human Interleukin 2, HEK
mIL 2 cyt-370 Recombinant Mouse Interleukin-2
mIL 2 His cyt-624 Recombinant Mouse Interleukin-2, His Tag
rIL 2 cyt-382 Recombinant Rat Interleukin-2
pIL 2 cyt-397 Recombinant Porcine Interleukin-2
qIL2 cyt-738 Recombinant Equine Interleukin-2
sIL 2R cyt-285 Recombinant Human Soluble Iinterleukin-2 Receptor alpha
IL 3 cyt-210 Recombinant Human Interleukin-3
IL 3 His cyt-482 Recombinant Human Interleukin-3, His Tag
IL 3 HEK cyt-096 Recombinant Human Interleukin 3, HEK
mIL 3 cyt-371 Recombinant Mouse Interleukin-3
rIL 3 cyt-383 Recombinant Rat Interleukin-3
IL 3 Sf9 cyt-417 Recombinant Human Interleukin-3, Sf9
k9 IL 3 cyt-722 Recombinant Canine Interleukin-3
rmIL3 cyt-156 Recombinant Rhesus Macaque Interleukin-3
IL 4 cyt-211 Recombinant Human Interleukin-4
IL 4 CHO cyt-271 Recombinant Human Interleukin-4 CHO
IL 4 His cyt-483 Recombinant Human Interleukin-4, His Tag
IL 4 HEK cyt-097 Recombinant Human Interleukin 4, HEK
mIL 4 cyt-282 Recombinant Mouse Interleukin-4
rIL 4 cyt-385 Recombinant Rat Interleukin-4
pIL 4 cyt-398 Recombinant Porcine Interleukin-4
rmIL4 cyt-172 Recombinant Rhesus Macaque Interleukin-4
IL 5 cyt-212 Recombinant Human Interleukin-5
mIL 5 cyt-689 Recombinant Mouse Interleukin-5
rIL 5 cyt-387 Recombinant Rat Interleukin-5
IL 6 cyt-213 Recombinant Human Interleukin-6
IL 6 CHO cyt-274 Recombinant Human Interleukin-6, CHO
IL 6 His cyt-484 Recombinant Human Interleukin-6, His Tag
IL 6 HEK cyt-098 Recombinant Human Interleukin 6, HEK
mIL 6 cyt-350 Recombinant Mouse Interleukin-6
rIL 6 cyt-388 Recombinant Rat Interleukin-6
pIL 6 cyt-399 Recombinant Porcine Interleukin-6
rmIL 6 cyt-174 Recombinant Rhesus Macaque Interleukin-6
sIL 6R cyt-286 Recombinant Human Soluble IL-6 Receptor alpha
IL 7 cyt-254 Recombinant Human Interleukin-7
IL 7 Yeast cyt-298 Recombinant Human Interleukin-7, Saccharomyces
IL 7 His cyt-485 Recombinant Human Interleukin-7, His Tag
IL 7, HEK cyt-197 Recombinant Human Interleukin-7, HEK
mIL 7 cyt-372 Recombinant Mouse Interleukin-7
rIL 7 cyt-163 Recombinant Rat Interleukin-7
IL 9 cyt-348 Recombinant Human Interleukin-9
IL 9 HEK cyt-099 Recombinant Human Interleukin 9, HEK
mIL 9 cyt-373 Recombinant Mouse Interleukin-9
rIL 9 cyt-748 Recombinant Rat Interleukin-9
IL 10 cyt-500 Recombinant Human Interleukin-10
IL 10 His cyt-486 Recombinant Human Interleukin-10, His Tag
IL 10 HEK cyt-100 Recombinant Human Interleukin 10, HEK
mIL 10 cyt-497 Recombinant Mouse Interleukin-10
rIL 10 cyt-465 Recombinant Rat Interleukin-10
pIL 10 cyt-404 Recombinant Porcine Interleukin-10
IL 11 cyt-214 Recombinant Human Interleukin-11
IL 11 Pichia cyt-013 Recombinant Human Interleukin-11, Pichia
mIL 11 cyt-646 Recombinant Mouse Interleukin-11
IL 12 cyt-101 Recombinant Human Interleukin 12
IL 12 p35 His cyt-487 Recombinant Human Interleukin-12 p35, His Tag
IL 12 p40 Baculovirus cyt-134 Recombinant Human Interleukin-12 p40, Baculovirus
IL 12 p40 His cyt-488 Recombinant Human Interleukin-12 p40, His Tag
IL 12 p40 Plant cyt-056 Recombinant Human Interleukin-12 p40, Plant
mIL 12 cyt-144 Recombinant Mouse Interleukin-12
rIL 12 cyt-390 Recombinant Rat Interleukin-12
IL 13 cyt-446 Recombinant Human Interleukin-13
IL 13 Variant cyt-682 Recombinant Human Interleukin-13 Variant
IL 13 His cyt-489 Recombinant Human Interleukin-13, His Tag
mIL 13 cyt-375 Recombinant Mouse Interleukin-13
rIL 13 cyt-391 Recombinant Rat Interleukin-13
rIL 13 109 a.a. cyt-182 Recombinant Rat Interleukin-13 109 a.a.
rmIL 13 cyt-175 Recombinant Rhesus Macaque Interleukin-13
IL 15 cyt-230 Recombinant Human Interleukin-15
IL 15 His cyt-490 Recombinant Human Interleukin-15, His Tag
mIL 15 cyt-344 Recombinant Mouse Interleukin-15
mIL 15 His cyt-647 Recombinant Mouse Interleukin-15, His Tag
rIL 15 cyt-345 Recombinant Rat Interleukin-15
pIL 15 cyt-403 Recombinant Porcine Interleukin-15
IL 16, (130 a.a.) cyt-536 Recombinant Human Interleukin-16, (130 a.a.)
IL 16, (121 a.a.) cyt-142 Recombinant Human Interleukin-16, (121 a.a.)
IL 16 His cyt-562 Recombinant Human Interleukin-16, His Tag
mIL 16 cyt-559 Recombinant Mouse Interleukin-16
maIL 16 cyt-153 Recombinant Rhesus Macaque Interleukin-16
IL 17A cyt-250 Recombinant Human Interleukin-17A
IL 17A His cyt-662 Recombinant Human Interleukin-17A His Tag
IL 17A HEK cyt-102 Recombinant Human Interleukin 17A, HEK
IL 17E cyt-583 Recombinant Human Interleukin-17E
IL 17F cyt-587 Recombinant Human Interleukin-17F
IL 17F HEK cyt-103 Recombinant Human Interleukin 17F, HEK
IL 17 A/F cyt-623 Recombinant Human Interleukin-17 A/F Heterodimer
mIL 17 cyt-378 Recombinant Mouse Interleukin-17A
mIL 17E cyt-641 Recombinant Mouse Interleukin-17E
mIL 17F cyt-642 Recombinant Mouse Interleukin-17F
mIL 17 A/F cyt-640 Recombinant Mouse Interleukin-17 A/F Heterodimer
rIL 17 A/F cyt-677 Recombinant Rat Interleukin-17 A/F Heterodimer
rIL 17 cyt-542 Recombinant Rat Interleukin-17A
rIL 17E cyt-576 Recombinant Rat Interleukin-17E
rIL 17F cyt-643 Recombinant Rat Interleukin-17F
IL 18 cyt-269 Recombinant Human Interleukin-18
IL 18 His cyt-663 Recombinant Human Interleukin-18 His Tag
IL18BP cyt-728 Recombinant Human Interleukin-18 Binding Protein
mIL 18 cyt-634 Recombinant Mouse Interleukin-18
rIL 18 cyt-376 Recombinant Rat Interleukin-18
IL 19 cyt-363 Recombinant Human Interleukin-19
mIL 19 cyt-411 Recombinant Mouse Interleukin-19
IL 20 cyt-347 Recombinant Human Interleukin-20
mIL 20 cyt-379 Recombinant Mouse Interleukin-20
IL 21 cyt-408 Recombinant Human Interleukin-21
mIL 21 cyt-684 Recombinant Mouse Interleukin-21
rIL 21 cyt-033 Recombinant Rat Interleukin-21
IL 22 cyt-328 Recombinant Human Interleukin-22
mIL 22 cyt-539 Recombinant Mouse Interleukin-22
rIL 22 cyt-173 Recombinant Rat Interleuikin-22
mIL 22 PEG cyt-701 Recombinant Mouse Interleukin-22, Pegylated
mIL 22A cyt-148 Recombinant Mouse Interleukin-22 Antagonist (E117A)
IL 23 cyt-050 Recombinant Human Interleukin-23
IL 23 His cyt-067 Recombinant Human Interleukin-23, His Tag
IL 24 cyt-515 Recombinant Human Interleukin-24
IL 27 cyt-048 Recombinant Human Interleukin-27 p28
mIL 27 cyt-570 Recombinant Mouse Interleukin-27
IL 28A cyt-602 Recombinant Human Interleukin-28A
IL 28A HEK cyt-104 Recombinant Human Interleukin-28A, HEK
mIL 28A cyt-741 Recombinant Mouse Interleukin-28A
IL 28B cyt-105 Recombinant Human Interleukin-28B
mIL 28B cyt-732 Recombinant Mouse Interleukin-28B
IL 29 cyt-603 Recombinant Human Interleukin-29
IL 29 HEK cyt-117 Recombinant Human Interleukin-29, HEK
IL 31 cyt-625 Recombinant Human Interleukin-31
mIL 31 cyt-604 Recombinant Mouse Interleukin-31
IL 32A cyt-584 Recombinant Human IL-32 alpha
IL 32A His Tag cyt-648 Recombinant Human IL-32 alpha His Tag
IL 33 cyt-425 Recombinant Human Interleukin-33
IL 33 His cyt-667 Recombinant Human Interleukin-33 His Tag
mIL 33 cyt-655 Recombinant Mouse Interleukin-33
rIL 33 cyt-150 Recombinant Rat Interleukin-33
IL34 cyt-042 Recombinant Human Interleukin-34
IL36RN cyt-009 Recombinant Human Interleukin-36 Receptor Antagonist
mIL36RN cyt-154 Recombinant Mouse Interleukin-36 Receptor Antagonist
IL36A cyt-158 Recombinant Human Interleukin-36 Alpha
IL36A 158 a.a. cyt-179 Recombinant Human Interleukin-36 Alpha 158 a.a.
mIL36A cyt-162 Recombinant Mouse Interleukin-36 Alpha
mIL36A 153 a.a. cyt-181 Recombinant Mouse Interleukin-36 Alpha 153 a.a.
IL36B cyt-159 Recombinant Human Interleukin-36 Beta
IL36B 153 a.a. cyt-180 Recombinant Human Interleukin-36 Beta 153 a.a
mIL36B cyt-165 Recombinant Mouse Interleukin-36 Beta
IL36G cyt-160 Recombinant Human Interleukin-36 Gamma
IL36G 152 a.a. cyt-161 Recombinant Human Interleukin-36 Gamma 152 a.a.
mIL36G cyt-745 Recombinant Mouse Interleukin-36 Gamma
IL37 cyt-011 Recombinant Human Interleukin 37
IL1F10 cyt-012 Recombinant Human Interleukin 1 Family, Member 10
Insulin cyt-270 Recombinant Human Insulin
Insulin Yeast cyt-614 Recombinant Human Insulin Yeast
pInsulin cyt-468 Porcine Insulin
KGF cyt-219 Recombinant Human Keratinocyte Growth Factor
mKGF cyt-721 Recombinant Mouse Keratinocyte Growth Factor
KGF HEK cyt-086 Recombinant Human Keratinocyte Growth Factor, HEK
KGF 2 cyt-303 Recombinant Human Keratinocyte Growth Factor-2
KGF 2 His cyt-129 Recombinant Human Keratinocyte Growth Factor-2, His Tag
mKGF 2 cyt-126 Recombinant Mouse Keratinocyte Growth Factor-2
rKGF cyt-127 Recombinant Rat Keratinocyte Growth Factor-2
Leptin cyt-228 Recombinant Human Leptin
Leptin cyt-683 Human Leptin
Leptin His cyt-287 Recombinant Human Leptin, His Tag
mLeptin cyt-351 Recombinant Mouse Leptin
mLeptin PEG cyt-591 Recombinant Pegylated Mouse Leptin
rLeptin cyt-227 Recombinant Rat Leptin
rLeptin PEG cyt-592 Recombinant Pegylated Rat Leptin
oLeptin cyt-239 Recombinant Ovine Leptin
oLeptin, MTS cyt-531 Recombinant Ovine Leptin, MTS tag
bLeptin cyt-502 Recombinant Bovine Leptin
pLeptin cyt-503 Recombinant Porcine Leptin
pfLeptin cyt-530 Recombinant Pufferfish Leptin
sLeptin cyt-704 Recombinant Salamander Leptin
hLeptin cyt-504 Recombinant Horse Leptin
chLeptin cyt-505 Recombinant Chicken Leptin
dLeptin cyt-506 Recombinant Dog Leptin
raLeptin cyt-507 Recombinant Rabbit Leptin
Leptin tA cyt-352 Recombinant Human Leptin Triple Antagonist
Leptin tA PEG cyt-702 Recombinant Human Leptin Triple Antagonist, Pegylated
Leptin qA cyt-353 Recombinant Human Leptin Quadruple Antagonist
mLeptin tA cyt-354 Recombinant Mouse Leptin Triple Antagonist
mLeptin tA PEG cyt-566 Recombinant Pegylated Mouse Leptin Triple Antagonist, Pegylated
rLeptin tA cyt-355 Recombinant Rat Leptin Triple Antagonist
rLeptin tA PEG cyt-567 Recombinant Pegylated Rat Leptin Triple Antagonist, Pegylated
oLeptin tA cyt-356 Recombinant Ovine Leptin Triple Antagonist
oLeptin tA PEG cyt-703 Recombinant Ovine Leptin Triple Antagonist, Pegylated
oLeptin qA cyt-357 Recombinant Ovine Leptin Quadruple Antagonist
Leptin Receptor cyt-508 Recombinant Human Leptin Binding Domain
chLeptin Receptor cyt-509 Recombinant Chicken Leptin Binding Domain
LFA 3 cyt-423 Recombinant Human Leukocyte Function Associated Antigen-3 Fusion Protein
LIF cyt-644 Recombinant Human Leukemia Inhibitory Factor
mLIF cyt-645 Recombinant Mouse Leukemia Inhibitory Factor
LIF GST cyt-001 Recombinant Human Leukemia Inhibitory Factor, GST tag
rLIF cyt-731 Recombinant Rat Leukemia Inhibitory Factor
MANF, His cyt-133 Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor, His Tag
MANF cyt-141 Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor
M CSF cyt-308 Recombinant Human Macrophage Colony Stimulating Factor
M CSF Baculovirus cyt-637 Recombinant Human Macrophage Colony Stimulating Factor, Baculovirus
M CSF HEK cyt-106 Recombinant Human Macrophage Colony Stimulating Factor, HEK
M CSF His cyt-695 Recombinant Human Macrophage Colony Stimulating Factor, His Tag
mM CSF cyt-439 Recombinant Mouse Macrophage Colony Stimulating Factor
rM CSF cyt-046 Recombinant Rat Macrophage Colony Stimulating Factor
MIF cyt-575 Recombinant Human Macrophage Migration Inhibitor Factor
MIF (Active) cyt-596 Recombinant Human Macrophage Migration Inhibitor Factor
MIF His N cyt-431 Recombinant Human Macrophage Migration Inhibitor Factor, His Tag N-Terminus
MIF His C cyt-521 Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus
mMIF cyt-744 Recombinant Mouse Macrophage Migration Inhibitor Factor
rMIF cyt-193 Recombinant Rat Macrophage Migration Inhibitor Factor
MIA cyt-310 Recombinant Human Melanoma Inhibitory Activity Protein
MIA2 cyt-638 Recombinant Human Melanoma Inhibitory Activity Protein 2
Midkine cyt-192 Recombinant Human Midkine
Midkine, His cyt-444 Recombinant Human Midkine, His Tag
mMidkine cyt-178 Recombinant Mouse Midkine
rMidkine cyt-747 Recombinant Rat Midkine
MTPN cyt-723 Recombinant Human Myotrophin
Myostatin cyt-418 Recombinant Human Myostatin
Myostatin His cyt-445 Recombinant Human Myostatin, His-Tag
Myostatin Propetide cyt-448 Recombinant Human Myostatin Propeptide
Myostatin Plant cyt-055 Recombinant Human Myostatin, Plant
NGB cyt-450 Recombinant Human Neuroglobin
NRG1 cyt-407 Recombinant Human Neuregulin-1/Heregulin-b2
NRG1 B1 cyt-733 Recombinant Human Neuregulin-1/Heregulin-b1
NRG1 A cyt-736 Recombinant Human Neuregulin-1/Heregulin Alpha (EGF Domain)
NT 3 cyt-257 Recombinant Human Neurotrophin-3
proNT3 cyt-015 Recombinant Human Precursor Neurotrophin-3
mNT 3 cyt-688 Recombinant Mouse Neurotrophin-3
NT 4 cyt-626 Recombinant Human Neurotrophin-4
Noggin cyt-475 Recombinant Human Noggin
Noggin HEK cyt-107 Recombinant Human Noggin, HEK
mNoggin cyt-600 Recombinant Mouse Noggin
Omentin cyt-301 Recombinant Human Omentin
Omentin His cyt-551 Recombinant Human Omentin His Tag
Omentin 298 a.a. cyt-061 Recombinant Human Omentin 298 a.a.
OPG Fc cyt-266 Recombinant Human Osteoprotegerin/Fc Chimera
OPG cyt-177 Recombinant Human Osteoprotegerin
OPG His cyt-290 Recombinant Human Osteoprotegerin, His Tag
OPG Hi-5 cyt-633 Recombinant Human Osteoprotegerin Hi-5
OSM cyt-231 Recombinant Human Oncostatin-M
OSM (209 a.a.) cyt-639 Recombinant Human Oncostatin-M (209 a.a.)
OSM (195 a.a.) cyt-735 Recombinant Human Oncostatin-M (195 a.a.)
OSM, His cyt-060 Recombinant Human Oncostatin-M, His Tag
OSM HEK cyt-108 Recombinant Human Oncostatin-M, HEK
mOSM cyt-168 Recombinant Mouse Oncostatin-M
rOSM cyt-169 Recombinant Rat Oncostatin-M
OSTF1 cyt-630 Recombinant Human Osteoclast Stimulating Factor-1
OTOR cyt-582 Recombinant Human Otoraplin
PDGF AA cyt-341 Recombinant Human Plaet Derived Growth Factor-AA
PDGF AA Yeast cyt-568 Recombinant Human Plaet Derived Growth Factor-AA, Yeast
PDGF AA HEK cyt-109 Recombinant Human Plaet Derived Growth Factor-AA HEK
PDGF A cyt-491 Recombinant Human Plaet Derived Growth Factor-A
mPDGF AA cyt-590 Recombinant Mouse Plaet Derived Growth Factor-AA
PDGF AB cyt-342 Recombinant Human Plaet Derived Growth Factor-AB
PDGF BB cyt-501 Recombinant Human Plaet Derived Growth Factor-BB
PDGF B cyt-492 Recombinant Human Plaet Derived Growth Factor-B
mPDGF BB cyt-412 Recombinant Mouse Plaet Derived Growth Factor-BB
rPDGF BB cyt-740 Recombinant Rat Plaet Derived Growth Factor-BB
PDGFD cyt-155 Recombinant Human Plaet Derived Growth Factor-D
PDGFRA cyt-065 Recombinant Human Plaet-Derived Growth Factor Receptor, Alpha
PEDF cyt-580 Recombinant Human Pigment Epithelium-Derived Factor
PEDF His cyt-552 Recombinant Human Pigment Epithelium-Derived Factor, His Tag
PEDF HEK cyt-553 Recombinant Human Pigment Epithelium-Derived Factor, HEK
Periostin cyt-452 Recombinant Human Periostin
PGRN cyt-524 Recombinant Human Progranulin
Pleiotrophin cyt-451 Recombinant Human Pleiotrophin
Pleiotrophin HEK cyt-198 Recombinant Human Pleiotrophin, HEK
Placental Lactogen cyt-656 Recombinant Human Placental Lactogen
bPlacental Lactogen cyt-511 Recombinant Bovine Placental Lactogen
oPlacental Lactogen cyt-512 Recombinant Ovine Placental Lactogen
cPlacental Lactogen cyt-510 Recombinant Caprine Placental Lactogen
PLGF 1 cyt-419 Recombinant Human Placenta Growth Factor-1
PLGF 2 cyt-420 Recombinant Human Placenta Growth Factor-2
Prolactin cyt-267 Recombinant Human Prolactin
Prolactin His cyt-493 Recombinant Human Prolactin, His Tag
mProlactin cyt-321 Recombinant Mouse Prolactin
rProlactin cyt-322 Recombinant Rat Prolactin
oProlactin cyt-240 Recombinant Ovine Prolactin
raProlactin cyt-513 Recombinant Rabbit Prolactin
Prl R, GST cyt-469 Recombinant Human Prolactin Receptor , GST Tag
Prl R cyt-595 Recombinant Human Prolactin Receptor
raPrl R cyt-268 Recombinant Rabbit Prolactin Soluble Receptor
oPrl R cyt-293 Recombinant Ovine Prolactin Soluble Receptor
bPrl R cyt-294 Recombinant Bovine Prolactin Soluble Receptor
tPrl R cyt-532 Recombinant Raibow Trout Prolactin Soluble Receptor
rPrl R cyt-533 Recombinant Rat Prolactin Soluble Receptor
oPrl A cyt-311 Recombinant Ovine Prolactin Antagonist
oPrl A Mutant cyt-705 Recombinant Ovine Prolactin Antagonist, Mutant
sCD4 cyt-304 Recombinant Human Soluble CD4
CD4 (26-226) cyt-313 Recombinant Human CD4 (26-226)
CD4 (125-202) cyt-315 Recombinant Human CD4 (125-202)
CD4 (203-317) cyt-316 Recombinant Human CD4 (203-317)
sCD40L cyt-245 Recombinant Human soluble CD40 Ligand/TRAP
sCD40L His cyt-670 Recombinant Human soluble CD40 Ligand/TRAP His Tag
msCD40L cyt-472 Recombinant Mouse soluble CD40 Ligand/TRAP
SCGB1A1 cyt-743 Recombinant Human Uteroglobin
mSCGB1A1 cyt-746 Recombinant Mouse Uteroglobin
SHH cyt-676 Recombinant Human Sonic HedgeHog
SHH, His cyt-717 Recombinant Human Sonic HedgeHog, His Tag
mSHH cyt-597 Recombinant Mouse Sonic HedgeHog
mSHH, His cyt-711 Recombinant Mouse Sonic HedgeHog, His Tag
DHH cyt-467 Recombinant Human Desert HedgeHog
DHH (C23II) cyt-362 Recombinant Human Desert HedgeHog (C23II)
sRANKL cyt-334 Recombinant Human Soluble RANK Ligand
sRANKL His cyt-692 Recombinant Human Soluble RANK Ligand, His Tag
sRANKL GST cyt-631 Recombinant Human Soluble RANK Ligand, GST Tag
msRANKL cyt-320 Recombinant Mouse Soluble RANK Ligand
sRANK Receptor cyt-734 Recombinant Human Soluble RANK Receptor
mRELM a cyt-309 Recombinant Mouse RELM-alpha
mRELM a His cyt-453 Recombinant Mouse RELM-alpha His Tag
RELM b cyt-454 Recombinant Human RELM-beta
mRELM b cyt-413 Recombinant Mouse RELM-beta
mRELM g cyt-455 Recombinant Mouse RELM-Gamma
Resistin cyt-456 Recombinant Human Resistin
Resistin His cyt-256 Recombinant Human Resistin, His Tag
Resistin Mutant cyt-585 Recombinant Human Resistin Mutant
mResistin cyt-457 Recombinant Mouse Resistin
rResistin cyt-458 Recombinant Rat Resistin
RBP1 cyt-122 Recombinant Human Retinol Binding Protein-1
RBP4 cyt-535 Recombinant Human Retinol Binding Protein-4
RBP4 His cyt-555 Recombinant Human Retinol Binding Protein-4 His Tag
RBP5 cyt-650 Recombinant Human Retinol Binding Protein-5
RBP7 cyt-023 Recombinant Human Retinol Binding Protein-7
SAA1 cyt-675 Recombinant Human Serum Amyloid A (APO-SAA1)
rmSAA1 cyt-719 Recombinant Rhesus Macaque Serum Amyloid A (APO-SAA1)
SAA4 cyt-002 Recombinant Human Serum Amyloid A4
SCF cyt-255 Recombinant Human Stem Cell Factor
mSCF cyt-275 Recombinant Mouse Stem Cell Factor
rSCF cyt-323 Recombinant Rat Stem Cell Factor
SCF Sf9 cyt-421 Recombinant Human Stem Cell Factor, Sf9
SCF HEK cyt-111 Recombinant Human Stem Cell Factor, HEK
k9SCF cyt-194 Recombinant Canine Stem Cell Factor
SF20 cyt-622 Recombinant Human Chromosome 19 Open Reading Frame 10
mSF20 cyt-678 Recombinant Mouse Chromosome 19 Open Reading Frame 10
SPP1 cyt-635 Recombinant Human Osteopontin
SPP1 HEK cyt-047 Recombinant Human Osteopontin, HEK
TACI cyt-032 Recombinant Human Tumor Necrosis Factor Receptor 13B
TAFA2 cyt-118 Recombinant Human Family with Sequence Similarity 19 Member A2
TDGF1 cyt-712 Recombinant Human Teratocarcinoma-Derived Growth Factor 1
TFF1 cyt-586 Recombinant Human Trefoil Factor-1
TFF1 His cyt-610 Recombinant Human Trefoil Factor-1 His Tag
TFF2 cyt-612 Recombinant Human Trefoil Factor-2
TFF2 His cyt-611 Recombinant Human Trefoil Factor-2 His Tag
TFF3 cyt-005 Recombinant Human Trefoil Factor-3
TFF3 His cyt-616 Recombinant Human Trefoil Factor-3 His Tag
TGF b 1 cyt-716 Recombinant Human Transforming Growth Factor-Beta 1
TGF b 1 cyt-561 Human Transforming Growth Factor-Beta 1
TGF b 1 GST cyt-473 Recombinant Human Transforming Growth Factor-Beta 1, GST tag
TGF b 1 His cyt-672 Recombinant Human Transforming Growth Factor-Beta 1 His Tag
TGF b 1 (113 a.a.) cyt-679 Recombinant Human Transforming Growth Factor-Beta 1 (113 a.a.)
TGF b 2 cyt-441 Recombinant Human Transforming Growth Factor-Beta 2
TGF b 2 HEK cyt-112 Recombinant Human Transforming Growth Factor-Beta 2, HEK
TGF b 3 cyt-368 Recombinant Human Transforming Growth Factor-Beta 3
TGF b 3 CHO cyt-685 Recombinant Human Transforming Growth Factor-Beta 3, CHO
TGF b 3 Plant cyt-588 Recombinant Human Transforming Growth Factor-Beta 3, Plant
TGF b 3 HEK cyt-113 Recombinant Human Transforming Growth Factor-Beta 3, HEK
TGF b 3 (207 a.a.) cyt-319 Recombinant Human Transforming Growth Factor-Beta 3 (644-850)
mTGF b 3 cyt-143 Recombinant Mouse Transforming Growth Factor-Beta 3
4 1BBR cyt-463 Recombinant Human 4-1BB Receptor
4 1BBR, His cyt-137 Recombinant Human 4-1BB Receptor His Tag
4 1BBL cyt-149 Recombinant Human 4-1BB Ligand
4 1BBL, His cyt-649 Recombinant Human 4-1BB Ligand, His Tag
TNF a cyt-223 Recombinant Human Tumor Necrosis Factor-alpha
TNF a His cyt-494 Recombinant Human Tumor Necrosis Factor-alpha, His Tag
TNF a HEK cyt-114 Recombinant Human Tumor Necrosis Factor-alpha, HEK
mTNF a cyt-252 Recombinant Mouse Tumor Necrosis Factor-alpha
rTNF a cyt-393 Recombinant Rat Tumor Necrosis Factor-alpha
rpTNF a cyt-405 Recombinant Porcine Tumor Necrosis Factor-alpha
raTNF a cyt-008 Recombinant Rabbit Tumor Necrosis Factor-alpha
rCaTNF a cyt-140 Recombinant Canine Tumor Necrosis Factor-alpha
rmTNF a cyt-737 Recombinant Rhesus Macaque Tumor Necrosis Factor-alpha
TNF a Mutant cyt-384 Recombinant Human Tumor Necrosis Factor-alpha, Mutant
TNF b cyt-224 Recombinant Human Tumor Necrosis Factor-beta
TNF b His cyt-495 Recombinant Human Tumor Necrosis Factor-beta, His Tag
TNFR2 cyt-674 Recombinant Human Tumor Necrosis Factor Receptor Type 2
TNFR2 Fc cyt-422 Recombinant Human Tumor Necrosis Factor Receptor 2 Fusion Protein
TNFRSF17 cyt-598 Recombinant Human B-Cell Maturation Antigen
TNFRSF17, His cyt-190 Recombinant Human B-Cell Maturation Antigen, His Tag
TNFR cyt-707 Recombinant Human Tumor Necrosis Factor Receptor
TNFR His cyt-673 Recombinant Human Tumor Necrosis Factor Receptor Type His Tag
TNFSF12 cyt-699 Recombinant Human TNF Ligand Superfamily Member 12
TNFRSF10B cyt-069 Recombinant Human TNF Ligand Receptor Superfamily Member 10B
TNFRSF12A cyt-043 Recombinant Human TNF Ligand Receptor Superfamily Member 12A
TSLP cyt-572 Recombinant Human Thymic Stromal Lymphopoietin
TSLPR cyt-742 Recombinant Human Thymic Stromal Lymphopoietin Receptor
TPO cyt-302 Recombinant Human Thrombopoietin
TPO CHO cyt-462 Recombinant Human Thrombopoietin, CHO
TPO HEK cyt-115 Recombinant Human Thrombopoietin, HEK
mTPO cyt-346 Recombinant Mouse Thrombopoietin
TRAIL cyt-443 Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L
TRAIL (114-281 a.a.) cyt-546 Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L (114-281)
ULBP1 cyt-166 Recombinant Human UL16 Binding Protein 1
Vaspin cyt-459 Recombinant Human Vaspin
VEGF cyt-241 Recombinant Human Vascular Endothelial Growth Factor
VEGF His cyt-496 Recombinant Human Vascular Endothelial Growth Factor, His Tag
VEGF CHO cyt-260 Recombinant Human Vascular Endothelial Growth Factor, CHO
VEGF HEK cyt-225 Recombinant Human Vascular Endothelial Growth Factor, HEK
VEGF Yeast cyt-577 Recombinant Human Vascular Endothelial Growth Factor, Yeast
VEGF (121a.a.) cyt-343 Recombinant Human Vascular Endothelial Growth Factor (121)
VEGF (121a.a.) Sf9 cyt-200 Recombinant Human Vascular Endothelial Growth Factor (121), Sf9
VEGF (121a.a.) His cyt-619 Recombinant Human Vascular Endothelial Growth Factor (121), His Tag
VEGF (121a.a.) HEK cyt-116 Recombinant Human Vascular Endothelial Growth Factor (121), HEK
rmVEGF cyt-336 Recombinant Mouse Vascular Endothelial Growth Factor
mVEGF Sf9 cyt-226 Recombinant Mouse Vascular Endothelial Growth Factor-Sf9
rmVEGF (121a.a.) cyt-574 Recombinant Mouse Vascular Endothelial Growth Factor (121)
rmVEGF His cyt-680 Recombinant Mouse Vascular Endothelial Growth Factor, His Tag
rVEGF cyt-392 Recombinant Rat Vascular Endothelial Growth Factor
VEGFB cyt-628 Recombinant Human Vascular Endothelial Growth Factor B
VEGF C cyt-527 Recombinant Human Vascular Endothelial Growth Factor Related Protein
rVEGF C cyt-262 Recombinant Rat Vascular Endothelial Growth Factor Related Protein
rVEGF C (152a.a.) cyt-284 Recombinant Rat Vascular Endothelial Growth Factor-C (152)
VEGF D cyt-045 Recombinant Human Vascular Endothelial Growth Factor D
VEGF E (Orf Virus) cyt-263 Recombinant Vascular Endothelial Growth Factor-E (Orf Virus)
VEGI cyt-517 Recombinant Human Vascular Endothelial Growth Inhibitor
VEGI His cyt-589 Recombinant Human Vascular Endothelial Growth Inhibitor, His Tag
Visfatin cyt-318 Recombinant Human Visfatin
Visfatin His cyt-563 Recombinant Human Visfatin, His Tag
mVisfatin cyt-447 Recombinant Mouse Visfatin
重慶市華雅干細(xì)胞技術(shù)有限公司 ：